PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019218-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 161aa    MW: 18140.4 Da    PI: 7.7149
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019218-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1566.2e-49398297
                  NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
                            e+dr+lPi+nv+rimkk+lP+ akisk+aket+qecvsefi+fvtseas++c++e+rkt+ngdd++wal++lGf++y +++  yl++ r
  SMil_00019218-RA_Salv  3 DENDRLLPISNVGRIMKKILPTSAKISKEAKETMQECVSEFIGFVTSEASERCHKENRKTVNGDDICWALSSLGFDNYSDTMPRYLQRLR 92
                           589*************************************************************************************** PP

                  NF-YB 92 elegek 97
                           e+e+++
  SMil_00019218-RA_Salv 93 EIESQR 98
                           **9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-482108IPR009072Histone-fold
SuperFamilySSF471132.02E-365105IPR009072Histone-fold
PfamPF008083.1E-26872IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-163654No hitNo description
PRINTSPR006151.8E-165573No hitNo description
PRINTSPR006151.8E-167492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MTDENDRLLP ISNVGRIMKK ILPTSAKISK EAKETMQECV SEFIGFVTSE ASERCHKENR  60
KTVNGDDICW ALSSLGFDNY SDTMPRYLQR LREIESQRAK QQGERKMKEG CCQCTPSSPP  120
SLHFVAILER DGGGERERES SSSSSAKTSQ LDNNTCILRK N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-39493392Transcription factor HapC (Eurofung)
4g92_B1e-39493392Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092666.16e-57PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO822489e-51NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0J8C1943e-52A0A0J8C194_BETVU; Uncharacterized protein
STRINGSolyc01g099320.2.12e-51(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.11e-51nuclear factor Y, subunit B5